General Information

  • ID:  hor001011
  • Uniprot ID:  P48757
  • Protein name:  Big gastrin
  • Gene name:  GAST
  • Organism:  Mus musculus (Mouse)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  Abundantly expressed in the stomach and duodenum. Low levels in brain, ovary and pancreas.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QLGPQGPQHFIADLSKKQRPRMEEEEEAYGWMDF
  • Length:  34
  • Propeptide:  MPRLCVYMLVLVLALATFSEASWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQLGPQGPQHFIADLSKKQRPRMEEEEEAYGWMDFGRRSAEEDQ
  • Signal peptide:  MPRLCVYMLVLVLALATFSEA
  • Modification:  T29 Sulfotyrosine;T34 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Cckbr
  • Target Unid:  P56481
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P48757-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001011_AF2.pdbhor001011_ESM.pdb

Physical Information

Mass: 463830 Formula: C179H267N49O55S2
Absent amino acids: CNTV Common amino acids: E
pI: 4.48 Basic residues: 5
Polar residues: 5 Hydrophobic residues: 8
Hydrophobicity: -124.71 Boman Index: -8860
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 40.29
Instability Index: 7013.24 Extinction Coefficient cystines: 6990
Absorbance 280nm: 211.82

Literature

  • PubMed ID:  NA
  • Title:  NA